SCOP 1.63: Domain d1ni2b1: 1ni2 B:88-198

Lineage for d1ni2b1 (1ni2 B:88-198)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)

5. Family a.11.2.1: Second domain of FERM [47032] (6 proteins)

6. Protein Ezrin [81714] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81715] (1 PDB entry)

8. Domain d1ni2b1: 1ni2 B:88-198 [80528]
   Other proteins in same PDB: d1ni2a2, d1ni2a3, d1ni2b2, d1ni2b3

Details for d1ni2b1

PDB Entry: 1ni2, 2.3 Å

PDB Description: structure of the active ferm domain of ezrin

SCOP Domain Sequences for d1ni2b1:

Sequence; same for both SEQRES and ATOM records:

>d1ni2b1 a.11.2.1 (B:88-198) Ezrin {Human (Homo sapiens)}
dvaeeliqditqklfflqvkegilsdeiycppetavllgsyavqakfgdynkevhksgyl
sserlipqrvmdqhkltrdqwedriqvwhaehrgmlkdnamleylkiaqdl

Timeline for d1ni2b1:

• d1ni2b1 is new in SCOP 1.63
  
• d1ni2b1 appears in SCOP 1.65
  
• d1ni2b1 appears in the current release, SCOPe 2.08