Lineage for d1ngwl2 (1ngw L:108-213)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293251Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1293252Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1293485Domain d1ngwl2: 1ngw L:108-213 [80495]
    Other proteins in same PDB: d1ngwa1, d1ngwb1, d1ngwb2, d1ngwh1, d1ngwh2, d1ngwl1
    part of metal chelatase catalytic Fab 7G12; chimeric affinity matured antibody
    complexed with mmp

Details for d1ngwl2

PDB Entry: 1ngw (more details), 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin
PDB Compounds: (L:) Mature Metal Chelatase Catalytic Antibody, Light chain

SCOPe Domain Sequences for d1ngwl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngwl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOPe Domain Coordinates for d1ngwl2:

Click to download the PDB-style file with coordinates for d1ngwl2.
(The format of our PDB-style files is described here.)

Timeline for d1ngwl2: