Lineage for d1n6ff1 (1n6f F:763-853)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396008Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 2396015Protein Tricorn protease [69253] (1 species)
  7. 2396016Species Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)
  8. 2396034Domain d1n6ff1: 1n6f F:763-853 [80193]
    Other proteins in same PDB: d1n6fa2, d1n6fa3, d1n6fa4, d1n6fb2, d1n6fb3, d1n6fb4, d1n6fc2, d1n6fc3, d1n6fc4, d1n6fd2, d1n6fd3, d1n6fd4, d1n6fe2, d1n6fe3, d1n6fe4, d1n6ff2, d1n6ff3, d1n6ff4
    complexed with dkt

Details for d1n6ff1

PDB Entry: 1n6f (more details), 2.7 Å

PDB Description: tricorn protease in complex with Z-Phe-diketo-Arg-Glu-Phe
PDB Compounds: (F:) tricorn protease

SCOPe Domain Sequences for d1n6ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ff1 b.36.1.3 (F:763-853) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

SCOPe Domain Coordinates for d1n6ff1:

Click to download the PDB-style file with coordinates for d1n6ff1.
(The format of our PDB-style files is described here.)

Timeline for d1n6ff1: