![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) ![]() possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller) |
![]() | Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein) |
![]() | Protein Tricorn protease N-terminal domain [69306] (1 species) |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries) |
![]() | Domain d1n6fc2: 1n6f C:39-319 [80182] Other proteins in same PDB: d1n6fa1, d1n6fa3, d1n6fa4, d1n6fb1, d1n6fb3, d1n6fb4, d1n6fc1, d1n6fc3, d1n6fc4, d1n6fd1, d1n6fd3, d1n6fd4, d1n6fe1, d1n6fe3, d1n6fe4, d1n6ff1, d1n6ff3, d1n6ff4 complexed with dkt |
PDB Entry: 1n6f (more details), 2.7 Å
SCOPe Domain Sequences for d1n6fc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6fc2 b.68.7.1 (C:39-319) Tricorn protease N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl ntdgrrilfskggsiyifnpdtekiekieigdlespedrii
Timeline for d1n6fc2: