Lineage for d1n6ee1 (1n6e E:763-853)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122898Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 1122905Protein Tricorn protease [69253] (1 species)
  7. 1122906Species Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)
  8. 1122915Domain d1n6ee1: 1n6e E:763-853 [80157]
    Other proteins in same PDB: d1n6ea2, d1n6ea3, d1n6ea4, d1n6ec2, d1n6ec3, d1n6ec4, d1n6ee2, d1n6ee3, d1n6ee4, d1n6eg2, d1n6eg3, d1n6eg4, d1n6ei2, d1n6ei3, d1n6ei4, d1n6ek2, d1n6ek3, d1n6ek4
    complexed with chm

Details for d1n6ee1

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative
PDB Compounds: (E:) tricorn protease

SCOPe Domain Sequences for d1n6ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ee1 b.36.1.3 (E:763-853) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

SCOPe Domain Coordinates for d1n6ee1:

Click to download the PDB-style file with coordinates for d1n6ee1.
(The format of our PDB-style files is described here.)

Timeline for d1n6ee1: