Lineage for d1n52b_ (1n52 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1205320Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1205321Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1205337Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 1205338Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries)
  8. 1205344Domain d1n52b_: 1n52 B: [80002]
    Other proteins in same PDB: d1n52a1, d1n52a2, d1n52a3
    protein/RNA complex; complexed with gol, gtg, mg, pg4

Details for d1n52b_

PDB Entry: 1n52 (more details), 2.11 Å

PDB Description: Cap Binding Complex
PDB Compounds: (B:) 20 kda nuclear cap binding protein

SCOPe Domain Sequences for d1n52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n52b_ d.58.7.1 (B:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
lkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksgd
ikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrqy
grgrsggqvrdeyrqdydagrggygkla

SCOPe Domain Coordinates for d1n52b_:

Click to download the PDB-style file with coordinates for d1n52b_.
(The format of our PDB-style files is described here.)

Timeline for d1n52b_: