SCOPe 2.03: Domain d1n52a2: 1n52 A:291-480

Lineage for d1n52a2 (1n52 A:291-480)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
   contains three domains of this fold connected with long linkers

7. Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)

8. Domain d1n52a2: 1n52 A:291-480 [80000]
   Other proteins in same PDB: d1n52b_
   protein/RNA complex; complexed with gol, gtg, mg, pg4

Details for d1n52a2

PDB Entry: 1n52, 2.11 Å

PDB Description: Cap Binding Complex

PDB Compounds: (A:) 80 kda nuclear cap binding protein

SCOPe Domain Sequences for d1n52a2:

Sequence; same for both SEQRES and ATOM records:

>d1n52a2 a.118.1.14 (A:291-480) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
mfdytddpegpvmpgshsverfvieenlhciikshwkerktcaaqlvsypgknkiplnyh
ivevifaelfqlpapphidvmyttllielcklqpgslpqvlaqatemlymrldtmnttcv
drfinwfshhlsnfqfrwswedwsdclsqdpespkpkfvrevlekcmrlsyhqrildivp
ptfsalcpan

Timeline for d1n52a2:

• d1n52a2 first appeared in SCOP 1.63
  
• d1n52a2 appears in SCOPe 2.02
  
• d1n52a2 appears in SCOPe 2.04
  
• d1n52a2 appears in the current release, SCOPe 2.08