![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (24 families) ![]() |
![]() | Family a.118.1.14: MIF4G domain-like [100908] (5 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
![]() | Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species) contains three domains of this fold connected with long linkers |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries) |
![]() | Domain d1n52a2: 1n52 A:291-480 [80000] Other proteins in same PDB: d1n52b_ protein/RNA complex; complexed with gol, gtg, mg, pg4 |
PDB Entry: 1n52 (more details), 2.11 Å
SCOPe Domain Sequences for d1n52a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n52a2 a.118.1.14 (A:291-480) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} mfdytddpegpvmpgshsverfvieenlhciikshwkerktcaaqlvsypgknkiplnyh ivevifaelfqlpapphidvmyttllielcklqpgslpqvlaqatemlymrldtmnttcv drfinwfshhlsnfqfrwswedwsdclsqdpespkpkfvrevlekcmrlsyhqrildivp ptfsalcpan
Timeline for d1n52a2: