SCOP 1.65: Domain d1n52a1: 1n52 A:26-290

Lineage for d1n52a1 (1n52 A:26-290)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (13 families)

5. Family a.118.1.2: HEAT repeat [48385] (3 proteins)
   this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain

6. Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
   contains three domains of this fold connected with long linkers

7. Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)

8. Domain d1n52a1: 1n52 A:26-290 [79999]
   Other proteins in same PDB: d1n52b_

Details for d1n52a1

PDB Entry: 1n52, 2.11 Å

PDB Description: Cap Binding Complex

SCOP Domain Sequences for d1n52a1:

Sequence; same for both SEQRES and ATOM records:

>d1n52a1 a.118.1.2 (A:26-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens)}
etedhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpeklti
yttlvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsm
vamfenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkr
rqkthvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealq
hnlppftppphtedsvypmprvifr

Timeline for d1n52a1:

• d1n52a1 first appeared in SCOP 1.63
  
• d1n52a1 appears in SCOP 1.67
  
• d1n52a1 appears in the current release, SCOPe 2.08