![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
![]() | Protein Ribosomal protein S15 [47065] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
![]() | Domain d1n34o_: 1n34 O: [79928] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOPe Domain Sequences for d1n34o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1n34o_: