SCOP 1.71: Domain d1n33s_: 1n33 S:

Lineage for d1n33s_ (1n33 S:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (20 PDB entries)

8. Domain d1n33s_: 1n33 S: [79910]
   Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33t_, d1n33v_
   complexed with mg, par, psu, zn

Details for d1n33s_

PDB Entry: 1n33, 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33s_:

Sequence; same for both SEQRES and ATOM records:

>d1n33s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1n33s_:

• d1n33s_ first appeared in SCOP 1.63
  
• d1n33s_ appears in SCOP 1.69
  
• d1n33s_ appears in SCOP 1.73
  
• d1n33s_ appears in the current release, SCOPe 2.08