Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) automatically mapped to Pfam PF00203 |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (2 species) |
Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) Uniprot P80381 |
Domain d1n33s_: 1n33 S: [79910] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33t_, d1n33v_ complexed with mg, par, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOPe Domain Sequences for d1n33s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1n33s_: