SCOPe 2.05: Domain d1n12c_: 1n12 C:

Lineage for d1n12c_ (1n12 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein PapE pilus subunit [81990] (1 species)

7. Species Escherichia coli [TaxId:562] [81991] (2 PDB entries)

8. Domain d1n12c_: 1n12 C: [79780]
   N-terminal-deleted; bound to a peptide corresponding to the n-terminal extension of the papk pilus subunit, chains B and D

Details for d1n12c_

PDB Entry: 1n12, 1.87 Å

PDB Description: Crystal structure of the PapE (N-terminal-deleted) pilus subunit bound to a peptide corresponding to the N-terminal extension of the PapK pilus subunit (residues 1-11) from uropathogenic E. coli

PDB Compounds: (C:) mature Fimbrial protein PapE

SCOPe Domain Sequences for d1n12c_:

Sequence, based on SEQRES records:

>d1n12c_ b.2.3.2 (C:) PapE pilus subunit {Escherichia coli [TaxId: 562]}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

Sequence, based on observed residues (ATOM records):

>d1n12c_ b.2.3.2 (C:) PapE pilus subunit {Escherichia coli [TaxId: 562]}
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmqnl
iagpfsatatlvasys

Timeline for d1n12c_:

• d1n12c_ first appeared in SCOP 1.63
  
• d1n12c_ appears in SCOPe 2.04
  
• d1n12c_ appears in SCOPe 2.06
  
• d1n12c_ appears in the current release, SCOPe 2.08