Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) |
Family b.52.1.3: Pollen allergen PHL P 1 N-terminal domain [82135] (1 protein) conserved Eng V active site residues and disulfides; better structural similarity to the ADC-like superfamily |
Protein Pollen allergen PHL P 1 N-terminal domain [82136] (1 species) |
Species Timothy grass (Phleum pratense) [TaxId:15957] [82137] (1 PDB entry) |
Domain d1n10a2: 1n10 A:1003-1145 [79775] Other proteins in same PDB: d1n10a1, d1n10b1 complexed with nag |
PDB Entry: 1n10 (more details), 2.9 Å
SCOPe Domain Sequences for d1n10a2:
Sequence, based on SEQRES records: (download)
>d1n10a2 b.52.1.3 (A:1003-1145) Pollen allergen PHL P 1 N-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]} pkvppgpnitatygdkwldakstwygkptgagpkdnggacgykdvdkppfsgmtgcgntp ifksgrgcgscfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkgde qklrsagelelqfrrvkckypeg
>d1n10a2 b.52.1.3 (A:1003-1145) Pollen allergen PHL P 1 N-terminal domain {Timothy grass (Phleum pratense) [TaxId: 15957]} pkvppgpnitatygdkwldakstwygggacgykdvdkppfsgmtgcgntpifksgrgcgs cfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkgdeqklrsagele lqfrrvkckypeg
Timeline for d1n10a2: