Lineage for d1mzhb1 (1mzh B:1101-1319)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834502Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2834506Species Aquifex aeolicus [TaxId:63363] [82271] (1 PDB entry)
  8. 2834508Domain d1mzhb1: 1mzh B:1101-1319 [79699]
    Other proteins in same PDB: d1mzha2, d1mzhb2
    structural genomics; QR15
    CASP5
    complexed with po4

Details for d1mzhb1

PDB Entry: 1mzh (more details), 2 Å

PDB Description: QR15, an Aldolase
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1mzhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzhb1 c.1.10.1 (B:1101-1319) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]}
midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvi
gfplglnktsvkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavh
kvivetpylneeeikkaveicieagadfiktstgfaprgttleevrlikssakgrikvka
sggirdletaismieagadrigtssgisiaeeflkrhli

SCOPe Domain Coordinates for d1mzhb1:

Click to download the PDB-style file with coordinates for d1mzhb1.
(The format of our PDB-style files is described here.)

Timeline for d1mzhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzhb2