Lineage for d1mx0b1 (1mx0 B:229-306)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348463Family a.156.1.3: Topoisomerase VI-B subunit middle domain [81705] (1 protein)
    automatically mapped to Pfam PF05833
  6. 2348464Protein Topoisomerase VI-B subunit middle domain [81706] (1 species)
  7. 2348465Species Sulfolobus shibatae [TaxId:2286] [81707] (7 PDB entries)
  8. 2348476Domain d1mx0b1: 1mx0 B:229-306 [79621]
    Other proteins in same PDB: d1mx0a2, d1mx0a3, d1mx0b2, d1mx0b3, d1mx0c2, d1mx0c3, d1mx0d2, d1mx0d3, d1mx0e2, d1mx0e3, d1mx0f2, d1mx0f3
    complexed with anp, mg, na

Details for d1mx0b1

PDB Entry: 1mx0 (more details), 2.3 Å

PDB Description: Structure of topoisomerase subunit
PDB Compounds: (B:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1mx0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx0b1 a.156.1.3 (B:229-306) Topoisomerase VI-B subunit middle domain {Sulfolobus shibatae [TaxId: 2286]}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

SCOPe Domain Coordinates for d1mx0b1:

Click to download the PDB-style file with coordinates for d1mx0b1.
(The format of our PDB-style files is described here.)

Timeline for d1mx0b1: