Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) |
Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins) contains an insert subdomain of ClpS-like fold |
Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species) the insert subdomain (residues 168-239) is fully ordered |
Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries) Uniprot O54286 27-668 |
Domain d1mwtb2: 1mwt B:139-327 [79602] Other proteins in same PDB: d1mwta1, d1mwta3, d1mwtb1, d1mwtb3 complexed with cd, cl |
PDB Entry: 1mwt (more details), 2.45 Å
SCOPe Domain Sequences for d1mwtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwtb2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]} dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk kdgkdiqlt
Timeline for d1mwtb2: