Lineage for d1mwad1 (1mwa D:1-117)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548189Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 548255Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (17 PDB entries)
  8. 548271Domain d1mwad1: 1mwa D:1-117 [79564]
    Other proteins in same PDB: d1mwaa2, d1mwab2, d1mwac2, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_
    complexed with acy, gol, man, nag

Details for d1mwad1

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwad1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOP Domain Coordinates for d1mwad1:

Click to download the PDB-style file with coordinates for d1mwad1.
(The format of our PDB-style files is described here.)

Timeline for d1mwad1: