Lineage for d1muja2 (1muj A:0-83)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255482Species Mouse (Mus musculus), I-AB [TaxId:10090] [75379] (2 PDB entries)
  8. 255483Domain d1muja2: 1muj A:0-83 [79489]
    Other proteins in same PDB: d1muja1, d1mujb1

Details for d1muja2

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: Crystal structure of murine class II MHC I-Ab in complex with a human CLIP peptide

SCOP Domain Sequences for d1muja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muja2 d.19.1.1 (A:0-83) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AB}
dieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqg
glqniavvkhnlgvltkrsnstpat

SCOP Domain Coordinates for d1muja2:

Click to download the PDB-style file with coordinates for d1muja2.
(The format of our PDB-style files is described here.)

Timeline for d1muja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1muja1