Lineage for d1mujb1 (1muj B:94-192)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220811Species Mouse (Mus musculus), I-AB [TaxId:10090] [74839] (2 PDB entries)
  8. 220813Domain d1mujb1: 1muj B:94-192 [79490]
    Other proteins in same PDB: d1muja2, d1mujb2
    complexed with nag

Details for d1mujb1

PDB Entry: 1muj (more details), 2.15 Å

PDB Description: crystal structure of murine class ii mhc i-ab in complex with a human clip peptide

SCOP Domain Sequences for d1mujb1:

Sequence, based on SEQRES records: (download)

>d1mujb1 b.1.1.2 (B:94-192) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AB}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewssae

Sequence, based on observed residues (ATOM records): (download)

>d1mujb1 b.1.1.2 (B:94-192) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AB}
leqpnvvislshntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtprrgevytchvehpslkspitvewssae

SCOP Domain Coordinates for d1mujb1:

Click to download the PDB-style file with coordinates for d1mujb1.
(The format of our PDB-style files is described here.)

Timeline for d1mujb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mujb2