SCOPe 2.01: Domain d1mq8a2: 1mq8 A:1-82

Lineage for d1mq8a2 (1mq8 A:1-82)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49163] (7 PDB entries)
Domain d1mq8a2: 1mq8 A:1-82 [79406]
Other proteins in same PDB: d1mq8a1, d1mq8b_, d1mq8c1, d1mq8d_
D1
complexed with mg, nag

Details for d1mq8a2

PDB Entry: 1mq8 (more details), 3.3 Å

PDB Description: crystal structure of alphal i domain in complex with icam-1

PDB Compounds: (A:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1mq8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mq8a2 b.1.1.4 (A:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

SCOPe Domain Coordinates for d1mq8a2:

Click to download the PDB-style file with coordinates for d1mq8a2.
(The format of our PDB-style files is described here.)

Timeline for d1mq8a2: