Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein OB-fold domains of BRCA2 [82099] (2 species) duplication: tandem repeat of three OB-fold domains |
Species Mouse (Mus musculus) [TaxId:10090] [82100] (2 PDB entries) |
Domain d1miua4: 1miu A:2723-2751,A:2888-2970 [79156] Other proteins in same PDB: d1miua1, d1miua2 protein/DNA complex; complexed with hg |
PDB Entry: 1miu (more details), 3.1 Å
SCOPe Domain Sequences for d1miua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miua4 b.40.4.3 (A:2723-2751,A:2888-2970) OB-fold domains of BRCA2 {Mouse (Mus musculus) [TaxId: 10090]} plplsslfsdggnvgcvdiivqrvyplqwXtvwklrvtsykkkeksallsiwrpssdlss lltegkryriyhlavskskskferpsiqltatkrtqyqqlpvssetllqvyqp
Timeline for d1miua4:
View in 3D Domains from same chain: (mouse over for more information) d1miua1, d1miua2, d1miua3, d1miua5 |