SCOPe 2.07: Domain d1mi1a2: 1mi1 A:2140-2248

Lineage for d1mi1a2 (1mi1 A:2140-2248)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.6: PreBEACH PH-like domain [82146] (2 proteins)

6. Protein PH-like domain of neurobeachin [82147] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82148] (1 PDB entry)

8. Domain d1mi1a2: 1mi1 A:2140-2248 [79138]
   Other proteins in same PDB: d1mi1a1, d1mi1b1

Details for d1mi1a2

PDB Entry: 1mi1, 2.9 Å

PDB Description: Crystal Structure of the PH-BEACH Domain of Human Neurobeachin

PDB Compounds: (A:) Neurobeachin

SCOPe Domain Sequences for d1mi1a2:

Sequence; same for both SEQRES and ATOM records:

>d1mi1a2 b.55.1.6 (A:2140-2248) PH-like domain of neurobeachin {Human (Homo sapiens) [TaxId: 9606]}
gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvg

Timeline for d1mi1a2:

• d1mi1a2 first appeared in SCOP 1.63
  
• d1mi1a2 appears in SCOPe 2.06
  
• d1mi1a2 appears in the current release, SCOPe 2.08