Lineage for d1mi1a2 (1mi1 A:2140-2248)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232087Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 232088Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 232258Family b.55.1.6: PH-like domain of neurobeachin [82146] (1 protein)
  6. 232259Protein PH-like domain of neurobeachin [82147] (1 species)
  7. 232260Species Human (Homo sapiens) [TaxId:9606] [82148] (1 PDB entry)
  8. 232261Domain d1mi1a2: 1mi1 A:2140-2248 [79138]
    Other proteins in same PDB: d1mi1a1, d1mi1b1

Details for d1mi1a2

PDB Entry: 1mi1 (more details), 2.9 Å

PDB Description: Crystal Structure of the PH-BEACH Domain of Human Neurobeachin

SCOP Domain Sequences for d1mi1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi1a2 b.55.1.6 (A:2140-2248) PH-like domain of neurobeachin {Human (Homo sapiens)}
gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwmf
seiravfsrryllqntalevfmanrtsvmfnfpdqatvkkvvyslprvg

SCOP Domain Coordinates for d1mi1a2:

Click to download the PDB-style file with coordinates for d1mi1a2.
(The format of our PDB-style files is described here.)

Timeline for d1mi1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mi1a1