SCOPe 2.01: Domain d1mfla_: 1mfl A:

Lineage for d1mfla_ (1mfl A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Erbin [82085] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)

8. Domain d1mfla_: 1mfl A: [79044]
   complexed with the carboxy-terminal tail of the erbb2 receptor

Details for d1mfla_

PDB Entry: 1mfl, 1.88 Å

PDB Description: The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor

PDB Compounds: (A:) Erb-B2 INTERACTING PROTEIN

SCOPe Domain Sequences for d1mfla_:

Sequence; same for both SEQRES and ATOM records:

>d1mfla_ b.36.1.1 (A:) Erbin {Human (Homo sapiens) [TaxId: 9606]}
gsmeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiq
angysfiniehgqavsllktfqntveliivrevss

Timeline for d1mfla_:

• d1mfla_ first appeared in SCOP 1.63
  
• d1mfla_ appears in SCOP 1.75
  
• d1mfla_ appears in SCOPe 2.02
  
• d1mfla_ appears in the current release, SCOPe 2.08, called d1mfla1