SCOPe 2.06: Domain d1mf8b_: 1mf8 B:

Lineage for d1mf8b_ (1mf8 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47532] (8 PDB entries)

8. Domain d1mf8b_: 1mf8 B: [79041]
   Other proteins in same PDB: d1mf8a_, d1mf8c_
   complexed with ca, po4

Details for d1mf8b_

PDB Entry: 1mf8, 3.1 Å

PDB Description: Crystal Structure of human calcineurin complexed with cyclosporin A and human cyclophilin

PDB Compounds: (B:) calcineurin b subunit isoform 1

SCOPe Domain Sequences for d1mf8b_:

Sequence; same for both SEQRES and ATOM records:

>d1mf8b_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd
gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk
dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvd

Timeline for d1mf8b_:

• d1mf8b_ first appeared in SCOP 1.63
  
• d1mf8b_ appears in SCOPe 2.05
  
• d1mf8b_ appears in SCOPe 2.07
  
• d1mf8b_ appears in the current release, SCOPe 2.08