SCOPe 2.01: Domain d1menb_: 1men B:

Lineage for d1menb_ (1men B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (4 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries)

8. Domain d1menb_: 1men B: [79033]
   complexed with gar

Details for d1menb_

PDB Entry: 1men, 2.23 Å

PDB Description: complex structure of human GAR Tfase and substrate beta-GAR

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1menb_:

Sequence; same for both SEQRES and ATOM records:

>d1menb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
rilvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhk
lyknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsn
aheqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpa
alqlvasgtvqlgengkicwv

Timeline for d1menb_:

• d1menb_ first appeared in SCOP 1.63
  
• d1menb_ appears in SCOP 1.75
  
• d1menb_ appears in SCOPe 2.02
  
• d1menb_ appears in the current release, SCOPe 2.08, called d1menb1