Lineage for d1ma9a2 (1ma9 A:199-386)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285651Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulphide-linked subdomains
  4. 285652Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 285653Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 285746Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 285747Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 285764Domain d1ma9a2: 1ma9 A:199-386 [78888]
    Other proteins in same PDB: d1ma9b1, d1ma9b2

Details for d1ma9a2

PDB Entry: 1ma9 (more details), 2.4 Å

PDB Description: Crystal structure of the complex of human vitamin D binding protein and rabbit muscle actin

SCOP Domain Sequences for d1ma9a2:

Sequence, based on SEQRES records: (download)

>d1ma9a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens)}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

Sequence, based on observed residues (ATOM records): (download)

>d1ma9a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens)}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdn
tkvmdkytfelsrrthlpevflskvleptlkslgeccsttcfnakgpllkkelssfidk

SCOP Domain Coordinates for d1ma9a2:

Click to download the PDB-style file with coordinates for d1ma9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ma9a2: