SCOPe 2.08: Domain d1ma9a2: 1ma9 A:199-386

Lineage for d1ma9a2 (1ma9 A:199-386)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1ma9a2: 1ma9 A:199-386 [78888]
   Other proteins in same PDB: d1ma9b1, d1ma9b2
   complexed with atp, mg

Details for d1ma9a2

PDB Entry: 1ma9, 2.4 Å

PDB Description: Crystal structure of the complex of human vitamin D binding protein and rabbit muscle actin

PDB Compounds: (A:) Vitamin D-binding protein

SCOPe Domain Sequences for d1ma9a2:

Sequence, based on SEQRES records:

>d1ma9a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

Sequence, based on observed residues (ATOM records):

>d1ma9a2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdn
tkvmdkytfelsrrthlpevflskvleptlkslgeccsttcfnakgpllkkelssfidk

Timeline for d1ma9a2:

• d1ma9a2 first appeared in SCOP 1.63
  
• d1ma9a2 appears in SCOPe 2.07