Lineage for d1m8vd_ (1m8v D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123078Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1123079Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1123190Species Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries)
  8. 1123222Domain d1m8vd_: 1m8v D: [78817]
    complexed with a uridine heptamer
    protein/RNA complex; complexed with ca, u

Details for d1m8vd_

PDB Entry: 1m8v (more details), 2.6 Å

PDB Description: structure of pyrococcus abyssii sm protein in complex with a uridine heptamer
PDB Compounds: (D:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1m8vd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8vd_ b.38.1.1 (D:) Archaeal homoheptameric Sm protein {Pyrococcus abyssi [TaxId: 29292]}
erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi
rgdnvlaispt

SCOPe Domain Coordinates for d1m8vd_:

Click to download the PDB-style file with coordinates for d1m8vd_.
(The format of our PDB-style files is described here.)

Timeline for d1m8vd_: