Lineage for d1m8vc_ (1m8v C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296506Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 296507Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 296508Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 296509Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 296620Species Archaeon Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries)
  8. 296651Domain d1m8vc_: 1m8v C: [78816]

Details for d1m8vc_

PDB Entry: 1m8v (more details), 2.6 Å

PDB Description: structure of pyrococcus abyssii sm protein in complex with a uridine heptamer

SCOP Domain Sequences for d1m8vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8vc_ b.38.1.1 (C:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi}
erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi
rgdnvlaispt

SCOP Domain Coordinates for d1m8vc_:

Click to download the PDB-style file with coordinates for d1m8vc_.
(The format of our PDB-style files is described here.)

Timeline for d1m8vc_: