SCOP 1.75: Domain d1m7xd1: 1m7x D:117-226

Lineage for d1m7xd1 (1m7x D:117-226)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (23 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
domains of unknown function associated with different type of catalytic domains in a different sequential location
subgroup of the larger IPT/TIG domain family

Protein 1,4-alpha-glucan branching enzyme, N-terminal domain N [81962] (1 species)
domain architecture similar to isoamylase
Species Escherichia coli [TaxId:562] [81963] (1 PDB entry)
Domain d1m7xd1: 1m7x D:117-226 [78758]
Other proteins in same PDB: d1m7xa2, d1m7xa3, d1m7xb2, d1m7xb3, d1m7xc2, d1m7xc3, d1m7xd2, d1m7xd3

Details for d1m7xd1

PDB Entry: 1m7x (more details), 2.3 Å

PDB Description: the x-ray crystallographic structure of branching enzyme

PDB Compounds: (D:) 1,4-alpha-glucan Branching Enzyme

SCOP Domain Sequences for d1m7xd1:

Sequence, based on SEQRES records: (download)

>d1m7xd1 b.1.18.2 (D:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

Sequence, based on observed residues (ATOM records): (download)

>d1m7xd1 b.1.18.2 (D:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmtaslicglpek

SCOP Domain Coordinates for d1m7xd1:

Click to download the PDB-style file with coordinates for d1m7xd1.
(The format of our PDB-style files is described here.)

Timeline for d1m7xd1: