SCOP 1.63: Domain d1m7xa2: 1m7x A:623-728

Lineage for d1m7xa2 (1m7x A:623-728)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein 1,4-alpha-glucan branching enzyme [82179] (1 species)

7. Species Escherichia coli [TaxId:562] [82180] (1 PDB entry)

8. Domain d1m7xa2: 1m7x A:623-728 [78750]
   Other proteins in same PDB: d1m7xa1, d1m7xa3, d1m7xb1, d1m7xb3, d1m7xc1, d1m7xc3, d1m7xd1, d1m7xd3

Details for d1m7xa2

PDB Entry: 1m7x, 2.3 Å

PDB Description: the x-ray crystallographic structure of branching enzyme

SCOP Domain Sequences for d1m7xa2:

Sequence; same for both SEQRES and ATOM records:

>d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

Timeline for d1m7xa2:

• d1m7xa2 is new in SCOP 1.63
  
• d1m7xa2 appears in SCOP 1.65
  
• d1m7xa2 appears in the current release, SCOPe 2.08