SCOP 1.63: Domain d1m67a2: 1m67 A:9-197

Lineage for d1m67a2 (1m67 A:9-197)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (10 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Glycerol-3- phosphate dehydrogenase [51881] (1 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51882] (5 PDB entries)

8. Domain d1m67a2: 1m67 A:9-197 [78692]
   Other proteins in same PDB: d1m67a1
   complexed with boa, plm

Details for d1m67a2

PDB Entry: 1m67, 2.5 Å

PDB Description: Crystal Structure of Leishmania mexicana GPDH Complexed with Inhibitor 2-bromo-6-hydroxy-purine

SCOP Domain Sequences for d1m67a2:

Sequence; same for both SEQRES and ATOM records:

>d1m67a2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana)}
kdellylnkavvfgsgafgtalamvlskkcrevcvwhmneeevrlvnekrenvlflkgvq
lasnitftsdvekayngaeiilfviptqflrgffeksggnliayakekqvpvlvctkgie
rstlkfpaeiigeflpspllsvlagpsfaievatgvftcvsiasadinvarrlqrimstg
drsfvcwat

Timeline for d1m67a2:

• d1m67a2 is new in SCOP 1.63
  
• d1m67a2 appears in SCOP 1.65
  
• d1m67a2 appears in the current release, SCOPe 2.08