Lineage for d1m5yb1 (1m5y B:25-163,B:396-427)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218802Fold a.167: Porin chaperone SurA, peptide-binding domain [81826] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 218803Superfamily a.167.1: Porin chaperone SurA, peptide-binding domain [81827] (1 family) (S)
  5. 218804Family a.167.1.1: Porin chaperone SurA, peptide-binding domain [81828] (1 protein)
  6. 218805Protein Porin chaperone SurA, peptide-binding domain [81829] (1 species)
  7. 218806Species Escherichia coli [TaxId:562] [81830] (1 PDB entry)
  8. 218808Domain d1m5yb1: 1m5y B:25-163,B:396-427 [78667]
    Other proteins in same PDB: d1m5ya2, d1m5ya3, d1m5yb2, d1m5yb3, d1m5yc2, d1m5yc3, d1m5yd2, d1m5yd3

Details for d1m5yb1

PDB Entry: 1m5y (more details), 3 Å

PDB Description: crystallographic structure of sura, a molecular chaperone that facilitates outer membrane porin folding

SCOP Domain Sequences for d1m5yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5yb1 a.167.1.1 (B:25-163,B:396-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli}
vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
evrrritilpqeveslaqqXrayrmlmnrkfseeaaswmqeqrasayvkils

SCOP Domain Coordinates for d1m5yb1:

Click to download the PDB-style file with coordinates for d1m5yb1.
(The format of our PDB-style files is described here.)

Timeline for d1m5yb1: