Lineage for d1m5vf_ (1m5v F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952186Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2952191Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 2952205Domain d1m5vf_: 1m5v F: [78663]
    domain 1, complex with a ribozyme
    protein/RNA complex; complexed with ca, mpd

Details for d1m5vf_

PDB Entry: 1m5v (more details), 2.4 Å

PDB Description: transition state stabilization by a catalytic rna
PDB Compounds: (F:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d1m5vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5vf_ d.58.7.1 (F:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakm

SCOPe Domain Coordinates for d1m5vf_:

Click to download the PDB-style file with coordinates for d1m5vf_.
(The format of our PDB-style files is described here.)

Timeline for d1m5vf_: