Lineage for d1m3yb2 (1m3y B:222-437)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2430859Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2430935Family b.121.2.3: Major capsid protein vp54 [82013] (2 proteins)
  6. 2430936Protein Major capsid protein vp54 [82014] (1 species)
  7. 2430937Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82015] (1 PDB entry)
    a large, lipid-containing, DNA virus
  8. 2430941Domain d1m3yb2: 1m3y B:222-437 [78582]
    complexed with hg, man, nag, ndg

Details for d1m3yb2

PDB Entry: 1m3y (more details), 2 Å

PDB Description: the structure of major capsid protein of a large, lipid containing, dna virus
PDB Compounds: (B:) The Major capsid protein of PBCV-1, Vp54

SCOPe Domain Sequences for d1m3yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3yb2 b.121.2.3 (B:222-437) Major capsid protein vp54 {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
lpheylieqlqftgsetatpsattqasqnirlnfnhptkylawnfnnptnygqytalani
pgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyq
siggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyktcsidatspaavlgnte
tvtantatlltalniyaknynvlrimsgmgglayan

SCOPe Domain Coordinates for d1m3yb2:

Click to download the PDB-style file with coordinates for d1m3yb2.
(The format of our PDB-style files is described here.)

Timeline for d1m3yb2: