SCOPe 2.08: Domain d1m3yb2: 1m3y B:222-437

Lineage for d1m3yb2 (1m3y B:222-437)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.3: Major capsid protein vp54 [82013] (2 proteins)

6. Protein Major capsid protein vp54 [82014] (1 species)

7. Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82015] (1 PDB entry)
   a large, lipid-containing, DNA virus

8. Domain d1m3yb2: 1m3y B:222-437 [78582]
   complexed with hg, man, nag, ndg

Details for d1m3yb2

PDB Entry: 1m3y, 2 Å

PDB Description: the structure of major capsid protein of a large, lipid containing, dna virus

PDB Compounds: (B:) The Major capsid protein of PBCV-1, Vp54

SCOPe Domain Sequences for d1m3yb2:

Sequence; same for both SEQRES and ATOM records:

>d1m3yb2 b.121.2.3 (B:222-437) Major capsid protein vp54 {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
lpheylieqlqftgsetatpsattqasqnirlnfnhptkylawnfnnptnygqytalani
pgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyq
siggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyktcsidatspaavlgnte
tvtantatlltalniyaknynvlrimsgmgglayan

Timeline for d1m3yb2:

• d1m3yb2 first appeared in SCOP 1.63
  
• d1m3yb2 appears in SCOPe 2.07