Lineage for d1m3ka1 (1m3k A:1-268)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1186522Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 1186791Protein Biosynthetic thiolase [53905] (1 species)
  7. 1186792Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries)
    Uniprot P07097
  8. 1186793Domain d1m3ka1: 1m3k A:1-268 [78565]
    complexed with gol, so4; mutant

Details for d1m3ka1

PDB Entry: 1m3k (more details), 1.7 Å

PDB Description: biosynthetic thiolase, inactive c89a mutant
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1m3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
gegqnparqaamkagvpqeatawgmnqlagsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

SCOPe Domain Coordinates for d1m3ka1:

Click to download the PDB-style file with coordinates for d1m3ka1.
(The format of our PDB-style files is described here.)

Timeline for d1m3ka1: