Lineage for d1m3dd2 (1m3d D:115-228)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608027Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 2608028Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 2608029Species Cow (Bos taurus) [TaxId:9913] [82820] (3 PDB entries)
    Uniprot P02462 1445-1667
  8. 2608097Domain d1m3dd2: 1m3d D:115-228 [78540]
    alpha 1 (chains A,B,D,E,G,H,J and K) and alpha 2 (chains C,F,I and L) isoforms
    complexed with br, gol, lu

Details for d1m3dd2

PDB Entry: 1m3d (more details), 2 Å

PDB Description: Structure of Type IV Collagen NC1 Domains
PDB Compounds: (D:) Type IV Collagen Noncollagenous Domain- Alpha1

SCOPe Domain Sequences for d1m3dd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3dd2 d.169.1.6 (D:115-228) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}
amvmavhsqtiqipqcptgwsslwigysfvmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrr

SCOPe Domain Coordinates for d1m3dd2:

Click to download the PDB-style file with coordinates for d1m3dd2.
(The format of our PDB-style files is described here.)

Timeline for d1m3dd2: