Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
Protein Biosynthetic thiolase [53905] (1 species) |
Species Zoogloea ramigera [TaxId:350] [53906] (12 PDB entries) Uniprot P07097 |
Domain d1m1ta1: 1m1t A:1-268 [78433] complexed with gol, so4; mutant |
PDB Entry: 1m1t (more details), 1.94 Å
SCOPe Domain Sequences for d1m1ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1ta1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa geganparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt vtagnasglndgaaaallmseaeasrrg
Timeline for d1m1ta1: