![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) automatically mapped to Pfam PF04234 automatically mapped to Pfam PF13205 |
![]() | Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [81972] (2 PDB entries) |
![]() | Domain d1lyqa_: 1lyq A: [78302] complexed with gol |
PDB Entry: 1lyq (more details), 1.5 Å
SCOPe Domain Sequences for d1lyqa_:
Sequence, based on SEQRES records: (download)
>d1lyqa_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]} ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakva pgadpksmviipreplpagtyrvdwravssdthpitgnytftvk
>d1lyqa_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]} ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkshspmpvaakvapga dpksmviipreplpagtyrvdwravssdthpitgnytftvk
Timeline for d1lyqa_: