Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) automatically mapped to Pfam PF04234 automatically mapped to Pfam PF13205 |
Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species) |
Species Escherichia coli [TaxId:562] [81972] (2 PDB entries) |
Domain d1lyqa_: 1lyq A: [78302] complexed with gol |
PDB Entry: 1lyq (more details), 1.5 Å
SCOPe Domain Sequences for d1lyqa_:
Sequence, based on SEQRES records: (download)
>d1lyqa_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]} ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakva pgadpksmviipreplpagtyrvdwravssdthpitgnytftvk
>d1lyqa_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]} ahpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkshspmpvaakvapga dpksmviipreplpagtyrvdwravssdthpitgnytftvk
Timeline for d1lyqa_: