![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.9: Hypothetical zinc finger protein YacG [82914] (1 protein) Zn-binding site is particularly similar to that of ribosomal protein L24e automatically mapped to Pfam PF03884 |
![]() | Protein Hypothetical zinc finger protein YacG [82915] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82916] (1 PDB entry) |
![]() | Domain d1lv3a_: 1lv3 A: [78231] complexed with zn |
PDB Entry: 1lv3 (more details)
SCOPe Domain Sequences for d1lv3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lv3a_ g.39.1.9 (A:) Hypothetical zinc finger protein YacG {Escherichia coli [TaxId: 562]} msetitvncptcgktvvwgeispfrpfcskrcqlidlgewaaeekripssgdlsesddws eepkq
Timeline for d1lv3a_: