Lineage for d1lrra_ (1lrr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007967Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily)
    consists of seven alpha-helices and three-stranded beta-sheet
  4. 3007968Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family) (S)
    automatically mapped to Pfam PF03925
  5. 3007969Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (2 proteins)
  6. 3007970Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species)
    binds to fully methylated and hemimethylated GATC sequences at oriC
  7. 3007971Species Escherichia coli [TaxId:562] [82811] (3 PDB entries)
    Uniprot P36658 71-181
  8. 3007973Domain d1lrra_: 1lrr A: [78165]
    protein/DNA complex

Details for d1lrra_

PDB Entry: 1lrr (more details), 2.65 Å

PDB Description: crystal structure of e. coli seqa complexed with hemimethylated dna
PDB Compounds: (A:) SeqA protein

SCOPe Domain Sequences for d1lrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrra_ d.228.1.1 (A:) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
tikdkvramrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaa
deqtllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti

SCOPe Domain Coordinates for d1lrra_:

Click to download the PDB-style file with coordinates for d1lrra_.
(The format of our PDB-style files is described here.)

Timeline for d1lrra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lrrd_