SCOP 1.63: Domain d1lqgb_: 1lqg B:

Lineage for d1lqgb_ (1lqg B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1lqgb_: 1lqg B: [78132]
   Other proteins in same PDB: d1lqgc_, d1lqgd_

Details for d1lqgb_

PDB Entry: 1lqg, 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1lqgb_:

Sequence; same for both SEQRES and ATOM records:

>d1lqgb_ c.18.1.1 (B:) Uracil-DNA glycosylase {Escherichia coli}
aneltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp

Timeline for d1lqgb_:

• d1lqgb_ is new in SCOP 1.63
  
• d1lqgb_ appears in SCOP 1.65
  
• d1lqgb_ appears in the current release, SCOPe 2.08