Lineage for d1lqga_ (1lqg A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240918Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 240919Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 240920Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 240921Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 240922Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 240932Domain d1lqga_: 1lqg A: [78131]
    Other proteins in same PDB: d1lqgc_, d1lqgd_

Details for d1lqga_

PDB Entry: 1lqg (more details), 2.9 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein

SCOP Domain Sequences for d1lqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
neltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilg
qdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlll
ntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhv
lkaphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpaes

SCOP Domain Coordinates for d1lqga_:

Click to download the PDB-style file with coordinates for d1lqga_.
(The format of our PDB-style files is described here.)

Timeline for d1lqga_: