Lineage for d1ll4d1 (1ll4 D:36-292,D:355-427)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146554Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1146555Protein Chitinase 1 [51548] (2 species)
  7. 1146585Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (4 PDB entries)
  8. 1146596Domain d1ll4d1: 1ll4 D:36-292,D:355-427 [78073]
    Other proteins in same PDB: d1ll4a2, d1ll4b2, d1ll4c2, d1ll4d2
    complexed with ami

Details for d1ll4d1

PDB Entry: 1ll4 (more details), 2.8 Å

PDB Description: structure of c. immitis chitinase 1 complexed with allosamidin
PDB Compounds: (D:) chitinase 1

SCOPe Domain Sequences for d1ll4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll4d1 c.1.8.5 (D:36-292,D:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

SCOPe Domain Coordinates for d1ll4d1:

Click to download the PDB-style file with coordinates for d1ll4d1.
(The format of our PDB-style files is described here.)

Timeline for d1ll4d1: