Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) |
Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
Protein Aminopeptidase PepV [82685] (1 species) contains insert sudbomain 205-292 mimicking the other half of the family-specific dimer |
Species Lactobacillus delbrueckii [TaxId:1584] [82686] (1 PDB entry) |
Domain d1lfwa2: 1lfw A:187-382 [77943] Other proteins in same PDB: d1lfwa1 complexed with aep, zn |
PDB Entry: 1lfw (more details), 1.8 Å
SCOPe Domain Sequences for d1lfwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lfwa2 d.58.19.1 (A:187-382) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} qgiftlefsfknddtkgdyvldkfkagiatnvtpqvtratisgpdleavklayesfladk eldgsfeindesadivligqgahasapqvgknsatflalfldqyafagrdknflhflaev ehedfygkklgifhhddlmgdlasspsmfdyehagkasllnnvrypqgtdpdtmikqvld kfsgildvtyngfeep
Timeline for d1lfwa2: