SCOPe 2.06: Domain d1lb2e_: 1lb2 E:

Lineage for d1lb2e_ (1lb2 E:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)

7. Species Escherichia coli [TaxId:562] [47792] (2 PDB entries)

8. Domain d1lb2e_: 1lb2 E: [77872]
   Other proteins in same PDB: d1lb2a1, d1lb2a2
   protein/DNA complex; protein/RNA complex; complexed with cmp

Details for d1lb2e_

PDB Entry: 1lb2, 3.1 Å

PDB Description: Structure of the E. coli alpha C-terminal domain of RNA polymerase in complex with CAP and DNA

PDB Compounds: (E:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1lb2e_:

Sequence; same for both SEQRES and ATOM records:

>d1lb2e_ a.60.3.1 (E:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
rglslg

Timeline for d1lb2e_:

• d1lb2e_ first appeared in SCOP 1.63
  
• d1lb2e_ appears in SCOPe 2.05
  
• d1lb2e_ appears in SCOPe 2.07
  
• d1lb2e_ appears in the current release, SCOPe 2.08